PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010525437.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family bZIP
Protein Properties Length: 721aa    MW: 77376.5 Da    PI: 6.5215
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010525437.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.11.8e-13231292162
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     e++ kr  r+++NRe+A+ sRqRKk +++eLeekv ++ +   +L ++++    e  +l+++
  XP_010525437.1 231 EEDEKRKARLMRNRESAQLSRQRKKHYVDELEEKVRAMHSTIADLNSKISYFMAENVTLRQQ 292
                     6788*******************************************999888777777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.7E-16231295IPR004827Basic-leucine zipper domain
PfamPF001701.1E-11232292IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.369233293IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.6E-17235293No hitNo description
SuperFamilySSF579595.69E-12235293No hitNo description
CDDcd147049.49E-22236286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 721 aa     Download sequence    Send to blast
MAKPVMEEPP PATASNPNFS SEFDSVSIPP FDHMFLSGSD QDPVGNLTSD LGFSFDGDDE  60
FELTFDGIDD LYFPAENETF LIPAAAGDQE QFGDFTPESE GSGISGDRVP GHEDNNMHCL  120
SSSSGSSERE IPRDSGDRCS GAERSLNSPS PVSSQGSGSG NCASGVSLTM NAPSPESGTM  180
VVEQKVKVEG GATPTTKRKK ENEEDASGDS RTSKYRRSTD NASAASAVTT EEDEKRKARL  240
MRNRESAQLS RQRKKHYVDE LEEKVRAMHS TIADLNSKIS YFMAENVTLR QQLGPGAGIC  300
PPPPPPLPPP GMYPPMAPMH HYPWMPCPPY MVKAQGSQVP LIPIPRLKPQ QPVSMSKAKN  360
KKSETKTKKV ASISFLGLLF CLFLFGALAP IVNINYGEYR SNYISDRFIV QPRGRVVDVN  420
GNLNGSDNGS GTRFSGSNRA QCGRDTDGVV PARNGSEPLV ASLFVPRNDK LMKIDGNLII  480
HSILASEKAM ATRQKDSETN NDRKTDLAIP KNFSPALPIP DAGRNGEKQK ALSSGSADDL  540
KDHFKSTAAN GKMQQWFREG LAGPMLSSGM CTEVFQFDVS TSGAIVPASS ASSVMTAHHK  600
NTTNNTNSGK NRRILRGLPV PLPVSDFNLT KNNSSRNSSS EDKLGETKPA SSSSSSSSSS  660
MVVSVLVDPR EGSDGDIDGN GMMGPKSLSR VFVVVLMDSV KYVTYSCVLP RPGGGPHLVA  720
S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010525437.10.0PREDICTED: uncharacterized protein LOC104803232
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLV4MJL00.0V4MJL0_EUTSA; Uncharacterized protein
STRINGscaffold_402899.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein